PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr029010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family NAC
Protein Properties Length: 348aa    MW: 39300.7 Da    PI: 9.2401
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr029010.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM161.33.6e-50151421128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 
                  lppGfrFhP+deel+v+yL++k+ +++l++ + i+e+d+yk++Pw+Lp+k+  +e+ewyfFs+r++ky++g+r+nr+++ gyWka g+dk++l++ ++
  Pbr029010.1  15 LPPGFRFHPSDEELIVHYLENKMISHPLPA-QLITEIDLYKYNPWELPNKALFGEDEWYFFSPRHRKYPNGERPNRTAAVGYWKAAGSDKPILTScGS 111
                  79****************************.89***************88888999********************99***************99888 PP

          NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                  + +g+kk Lvfy+grapkg+kt+W+m+eyrl
  Pbr029010.1 112 KRIGVKKALVFYTGRAPKGVKTEWIMNEYRL 142
                  89***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.02E-6010168IPR003441NAC domain
PROSITE profilePS510055815169IPR003441NAC domain
PfamPF023652.3E-2516142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MEKEPAFTTY STMHLPPGFR FHPSDEELIV HYLENKMISH PLPAQLITEI DLYKYNPWEL  60
PNKALFGEDE WYFFSPRHRK YPNGERPNRT AAVGYWKAAG SDKPILTSCG SKRIGVKKAL  120
VFYTGRAPKG VKTEWIMNEY RLLHCTVNPS RCKGSMRLDD WVLCRVQQRG NSTKNTCNAQ  180
DIYNTEFWRC LPKSGLTVRP TNPIHRADII TDFLYKDCRV LASILAGQPP SPIETSSASF  240
QGSKDSYPVG SNNKVKSTVS ISSSGINSTL KRKIREENTK ENLFPLINLE SKNKDGNVLP  300
SKKLAAGNVV NCYIPNHLQN DIPKANPTVP ANFEEFNEMA FLDTYSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-701117513171NO APICAL MERISTEM PROTEIN
1ut4_B1e-701117513171NO APICAL MERISTEM PROTEIN
1ut7_A1e-701117513171NO APICAL MERISTEM PROTEIN
1ut7_B1e-701117513171NO APICAL MERISTEM PROTEIN
3swm_A1e-701117516174NAC domain-containing protein 19
3swm_B1e-701117516174NAC domain-containing protein 19
3swm_C1e-701117516174NAC domain-containing protein 19
3swm_D1e-701117516174NAC domain-containing protein 19
3swp_A1e-701117516174NAC domain-containing protein 19
3swp_B1e-701117516174NAC domain-containing protein 19
3swp_C1e-701117516174NAC domain-containing protein 19
3swp_D1e-701117516174NAC domain-containing protein 19
4dul_A1e-701117513171NAC domain-containing protein 19
4dul_B1e-701117513171NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009338296.10.0PREDICTED: NAC domain-containing protein 2-like
SwissprotQ9LD446e-74NAC56_ARATH; NAC transcription factor 56
TrEMBLM5W7331e-170M5W733_PRUPE; Uncharacterized protein
STRINGGLYMA12G29360.11e-115(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF24162981
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.15e-75NAC domain containing protein 25